Gift Guide: find the right starting point

Start with what you already know: who the gift is for, your budget, the occasion, or whether a popular choice would be the safest place to begin.

Gaveguide

22830 Produkter

Viser 13009 - 13056 av 22830 Produkter

Viser 13009 - 13056 av 22830 Produkter
Utsikt
Nieuw
Herma Round Removable Labels 100pc (White)Herma Round Removable Labels 100pc (White)
Velg alternativer
Nieuw
Herma Round Sticker Labels (Pink)Herma Round Sticker Labels (Pink)
Herma Herma Round Sticker Labels (Pink)
SalgsprisCHF 6.99
På lager
Velg alternativer
Nieuw
Herma Round Sticker Labels (Red)Herma Round Sticker Labels (Red)
Herma Herma Round Sticker Labels (Red)
SalgsprisCHF 6.99
På lager
Velg alternativer
Nieuw
Herma Round Sticker Labels (White)Herma Round Sticker Labels (White)
Herma Herma Round Sticker Labels (White)
SalgsprisCHF 6.99
På lager
Velg alternativer
Nieuw
Herma Round Sticker Labels (Yellow)Herma Round Sticker Labels (Yellow)
Herma Herma Round Sticker Labels (Yellow)
SalgsprisCHF 6.99
På lager
Velg alternativer
Nieuw
Herma Santa Glittery Cardboard Sticker
Herma Herma Santa Glittery Cardboard Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Shabby Chic Motif File A4Herma Shabby Chic Motif File A4
Herma Herma Shabby Chic Motif File A4
SalgsprisCHF 14.99
På lager
Velg alternativer
Nieuw
Herma Sheep Sticker Decor
Herma Herma Sheep Sticker Decor
SalgsprisCHF 6.99
På lager
Nieuw
Herma Shipping 3D Glittery Sticker
Herma Herma Shipping 3D Glittery Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Snow Men Sticker Decor
Herma Herma Snow Men Sticker Decor
SalgsprisCHF 6.99
På lager
Nieuw
Herma Snow White Sticker
Herma Herma Snow White Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Snowman Stone Sticker
Herma Herma Snowman Stone Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Soccer Animals 3D Sticker
Herma Herma Soccer Animals 3D Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Soccer Friends Sticker Decor
Herma Herma Soccer Friends Sticker Decor
SalgsprisCHF 6.99
På lager
Nieuw
Herma Social Media Icons Cardboard Sticker
Nieuw
Herma Square Removable Labels 25pc (White)Herma Square Removable Labels 25pc (White)
Velg alternativer
Nieuw
Herma Star Glam Rocks Sticker
Herma Herma Star Glam Rocks Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Stars Decor StickerHerma Stars Decor Sticker
Herma Herma Stars Decor Sticker
SalgsprisCHF 6.99
På lager
Velg alternativer
Nieuw
Herma Stars Prismatic Foil Sticker
Herma Herma Stars Prismatic Foil Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Stick Figures Sticker Decor
Herma Herma Stick Figures Sticker Decor
SalgsprisCHF 6.99
På lager
Nieuw
Herma Summer Animals Transpuffy Sticker
Herma Herma Summer Animals Transpuffy Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Sweet Bakery Glittery Foil Sticker
Herma Herma Sweet Bakery Glittery Foil Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Sweet Cat Sticker Decor
Herma Herma Sweet Cat Sticker Decor
SalgsprisCHF 6.99
På lager
Nieuw
Herma Transparent Adhesive Film Glossy Roll 40cmHerma Transparent Adhesive Film Glossy Roll 40cm
Nieuw
Herma Transparent Film Number Sticker #0-9 8mm (Gold)
Nieuw
Herma Transparent Film Number Sticker #1-100 5mm (Black)
Nieuw
Herma Transparent Matte Labels A4 25pcHerma Transparent Matte Labels A4 25pc
Herma Herma Transparent Matte Labels A4 25pc
SalgsprisCHF 59.99
På lager
Velg alternativer
Nieuw
Herma Underwater Animals Stone Sticker
Herma Herma Underwater Animals Stone Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Unicorns Stone Sticker
Herma Herma Unicorns Stone Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Universal Bag A4+ (36x28cm)Herma Universal Bag A4+ (36x28cm)
Herma Herma Universal Bag A4+ (36x28cm)
SalgsprisCHF 7.99
På lager
Velg alternativer
Nieuw
Herma Universal Bag A5 (26x20cm)Herma Universal Bag A5 (26x20cm)
Herma Herma Universal Bag A5 (26x20cm)
SalgsprisCHF 6.99
På lager
Velg alternativer
Nieuw
Herma Universal Bag A6 (19x14cm)Herma Universal Bag A6 (19x14cm)
Herma Herma Universal Bag A6 (19x14cm)
SalgsprisCHF 6.99
På lager
Velg alternativer
Nieuw
Herma Universal Bag A7 (14x11cm)Herma Universal Bag A7 (14x11cm)
Herma Herma Universal Bag A7 (14x11cm)
SalgsprisCHF 6.99
På lager
Velg alternativer
Nieuw
Herma Valentines Post 3D Paper Sticker
Herma Herma Valentines Post 3D Paper Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Vario Tab DispenserHerma Vario Tab Dispenser
Herma Herma Vario Tab Dispenser
SalgsprisCHF 18.99
På lager
Velg alternativer
Nieuw
Herma Vikings Sticker
Herma Herma Vikings Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Water-Coloured Birds Sticker Decor
Herma Herma Water-Coloured Birds Sticker Decor
SalgsprisCHF 6.99
På lager
Nieuw
Herma Wings Glam Rocks Sticker
Herma Herma Wings Glam Rocks Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Zebras 3D Foil Sticker
Herma Herma Zebras 3D Foil Sticker
SalgsprisCHF 6.99
På lager
Nieuw
Herma Zoo Animals Sticker Decor
Herma Herma Zoo Animals Sticker Decor
SalgsprisCHF 6.99
På lager
High Efficiency Fan Type HeatsinkHigh Efficiency Fan Type Heatsink
TechBrands Høy effektivitetsviftentypevarsink
SalgsprisFra CHF 10.99
På lager
Velg alternativer
High Strength Bow ShackleHigh Strength Bow Shackle
CMP Høy styrke Bow Shackle
SalgsprisFra CHF 15.99
På lager
Velg alternativer
Nieuw
History of the Holden V8 Softcover Book by Fiv Antoniou
Nieuw
Holden 1948-1963 FX FJ FE FC FB EK EJ Repair Manual
Nieuw
Holden 1963-1968 EH HD HR Repair Manual
Ellery Holden 1963-1968 EH HD HR Repair Manual
SalgsprisCHF 41.99
På lager
Nieuw
Holden 1971-1978 HQ HJ HX HZ Repair Manual

More ways to shop when the brief gets specific

Use these as quick detours once you know the occasion, fandom or practical gift style.

Recently viewed

Gift ideas by recipient, budget, occasion and the kind of surprise that lands

Quick ways to narrow the gift search

  • Start with the recipient, especially if the gift needs to suit a partner, parent, coworker, teen, friend or hard-to-buy-for person.
  • Use the occasion, when timing, tone or public handover matters more than the product type.
  • Set the budget early, so the shortlist feels generous without wandering into regret.
  • Match the personality, then check whether the product is practical, funny, nostalgic, display-worthy or easy to share.

The best shortcut is to decide what kind of reaction you want. A desk gadget should make a workday easier. A game should suit the group that will actually play it. A novelty gift should fit the person, not just the joke. A home or kitchen item should have a clear job. Product details still matter: check dimensions, contents, age guidance, compatibility and current availability before choosing.

For a recipient-led start, compare Gifts by Recipient, Gifts for Men and Gifts for Women. If the budget is the anchor, Under $30 Gifts keeps choices tight. For seasonal pressure, Christmas Gifts is a useful jump point, while Top Selling Gifts can help when you want proven browsing momentum.

High-confidence gift paths to try next

How do I start choosing a gift?
Start with the recipient and the setting. Then narrow by budget, occasion and whether the gift should be useful, funny, sentimental, hobby-led or easy to share.

What if I do not know their exact interests?
Choose safer categories such as practical desk items, home helpers, games, food-adjacent gifts or small novelty pieces with broad appeal.

Are budget gifts still thoughtful?
Yes, when they connect to a routine, joke, hobby or moment. A specific small gift usually beats a vague expensive one.